PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_12032_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 796aa    MW: 88292.4 Da    PI: 7.2197
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_12032_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.65.4e-4159136178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqve+C+adls+ak+yhrrhkvC++hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Neem_12032_f_1  59 VCQVEDCRADLSNAKDYHRRHKVCDMHSKATKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTHP 136
                     6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-3256121IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.12957134IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.76E-3858139IPR004333Transcription factor, SBP-box
PfamPF031103.2E-2960133IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 796 aa     Download sequence    Send to blast
KRELEKRRRV VVVEDEELNN DEVGSLNLNL GGQVYPVVDG DVKSGKKTKI VGSAVSRAVC  60
QVEDCRADLS NAKDYHRRHK VCDMHSKATK ALVGNVMQRF CQQCSRFHVL QEFDEGKRSC  120
RRRLAGHNKR RRKTHPDNVV SGGSLNDERG SSYLLISLLR ILANMHSNNS DQTKDQDLLS  180
HLFRNLAGVV GTNNVRNISG LLQGSQGLLN AGTSNGNVEK VSDVVSTGPE PVRSSASASM  240
IDHCIRFSDP LRSVGQSGSV PASDLIQKRI AAHDARSGIV QGLLGCQSKE AFPSRDSLSA  300
KANELEATFG RSKMSNIDLN NVYDDSQDHI ENLERSINLG TGSLCSRLWV QPASNKSTPP  360
QTSANSDSTS SQSPSSSSGD AQSRTDRIVF KLFGKDPNDF PIVLRRQILD WLSHSPTDIE  420
SYIRPGCIIL TIYLRLGKPT WEELCCDLGS SLRKLLDSSD DSFWRMGWLY ARVQHSVAFV  480
YNGLLLLPLI SSVKPIAVSV SARAKFMVKG FNLSWSTTRL LCAIEGKYLV QEACYDLMDG  540
ADEHDELQHL SFVCSMPNVY GRGFIEVEDH GLSSSFFPFI VAEQEVCSEI CMLEGVIEAA  600
EISDNFQKIS EKTEIKDQAL DFVHEMGWLL HRSRVKFRLG HLDSNSGLFS FKRFRWLMEF  660
SMERDWCAVV KKLLGILFEG TVDTGEHTSI ELALLDMGLL HRAVRRNCRP MVELLLHFSP  720
GKELGKLGPQ QKQLVDKAGS SFIFKPDVIG PAGLTPLHVA ACRDDAEHVL DALTDDPGLV  780
RFHLLIPVLL NSNPLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-30591331084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
159KRRRV
2128134KRRRKTH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488746.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
RefseqXP_006488747.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLV4S1A60.0V4S1A6_9R
STRINGPOPTR_0008s09810.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12